fasta
Differences
This shows you the differences between two versions of the page.
Both sides previous revisionPrevious revisionNext revision | Previous revision | ||
fasta [2007/12/17 12:00] – heidi | fasta [2008/07/22 13:31] (current) – external edit 127.0.0.1 | ||
---|---|---|---|
Line 1: | Line 1: | ||
====== FASTA ====== | ====== FASTA ====== | ||
- | FASTA format is a text-based format for representing either nucleic acid sequences or peptide sequences, in which base pairs or amino acids are represented using single-letter codes. The format also allows for sequence names and comments to precede the sequences | + | **[[http:// |
+ | [[http:// | ||
+ | |||
+ | \\ | ||
+ | FASTA format is a text-based format for representing either nucleic acid sequences or peptide sequences, in which base pairs or amino acids are represented using single-letter codes. The format also allows for sequence names and comments to precede the sequences. | ||
+ | |||
+ | |||
+ | ===== format information ===== | ||
+ | * text based | ||
+ | * no standard file extension for a text file containing FASTA formatted sequences. FASTA format files often have file extensions like .fa, .mpfa, .fna, .fsa, .fas or .fasta | ||
- | ===== Program information ===== | ||
===== Data type handled ===== | ===== Data type handled ===== | ||
- | ===== Input Files ===== | + | * nucleic acid sequences |
- | ===== How to cite ===== | + | * peptide sequences |
+ | |||
+ | |||
+ | |||
+ | |||
+ | |||
+ | |||
+ | |||
+ | |||
+ | ===== file format | ||
+ | * begins with a single-line description, | ||
+ | * It is recommended that all lines of text be shorter than 80 characters | ||
+ | * The sequence ends if another line starting with a ">" | ||
+ | **simple examples: | ||
+ | < | ||
+ | > | ||
+ | LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLFSAIPYIGTNLV | ||
+ | EWIWGGFSVDKATLNRFFAFHFILPFTMVALAGVHLTFLHETGSNNPLGLTSDSDKIPFHPYYTIKDFLG | ||
+ | LLILILLLLLLALLSPDMLGDPDNHMPADPLNTPLHIKPEWYFLFAYAILRSVPNKLGGVLALFLSIVIL | ||
+ | GLMPFLHTSKHRSMMLRPLSQALFWTLTMDLLTLTWIGSQPVEYPYTIIGQMASILYFSIILAFLPIAGX | ||
+ | IENY | ||
+ | </ | ||
+ | |||
+ | example of a multiple sequence FASTA file: | ||
+ | < | ||
+ | > | ||
+ | MTEITAAMVKELRESTGAGMMDCKNALSETNGDFDKAVQLLREKGLGKAAKKADRLAAEG | ||
+ | LVSVKVSDDFTIAAMRPSYLSYEDLDMTFVENEYKALVAELEKENEERRRLKDPNKPEHK | ||
+ | IPQFASRKQLSDAILKEAEEKIKEELKAQGKPEKIWDNIIPGKMNSFIADNSQLDSKLTL | ||
+ | MGQFYVMDDKKTVEQVIAEKEKEFGGKIKIVEFICFEVGEGLEKKTEDFAAEVAAQL | ||
+ | > | ||
+ | SATVSEINSETDFVAKNDQFIALTKDTTAHIQSNSLQSVEELHSSTINGVKFEEYLKSQI | ||
+ | ATIGENLVVRRFATLKAGANGVVNGYIHTNGRVGVVIAAACDSAEVASKSRDLLRQICMH | ||
+ | </ | ||
+ | |||
+ | === Header line === | ||
+ | * begins with ">" | ||
+ | * word following is the identifier and/or name of the sequence (optional) | ||
+ | * rest of the line is the description (optional) | ||
+ | * no space between the ">" | ||
+ | * header line may contain more than one header separated by a ^A (Control-A) character | ||
+ | |||
+ | \\ | ||
+ | * Sequence identifiers: | ||
+ | * Many different sequence databases use standardized headers, which helps when automatically extracting information from the header | ||
+ | * NCBI defined a standard for the unique identifier | ||
+ | * they do not give a definitive description of the FASTA defline format, an attempt | ||
+ | |||
+ | | GenBank | ||
+ | | EMBL Data Library | ||
+ | | DDBJ, DNA Database of Japan | '' | ||
+ | | NBRF PIR | '' | ||
+ | | Protein Research Foundation | ||
+ | | SWISS-PROT | ||
+ | | Brookhaven Protein Data Bank (1) | '' | ||
+ | | Brookhaven Protein Data Bank (2) | '' | ||
+ | | Patents | ||
+ | | GenInfo Backbone Id | '' | ||
+ | | General database identifier | ||
+ | | NCBI Reference Sequence | ||
+ | | Local Sequence identifier | ||
+ | //Anm: Die gi-Nummer ist eine Abfolge von Ziffern, die einen Datenbankeintrag des NCBI markiert.// | ||
+ | |||
+ | \\ | ||
+ | === Sequence representation | ||
+ | * After the header line and comments | ||
+ | * each line of a sequence should have fewer than 80 characters | ||
+ | * Sequences may be protein sequences or nucleic acid sequences | ||
+ | * can contain gaps or alignment characters | ||
+ | * Sequences are expected to be represented in the standard IUB/IUPAC amino acid and nucleic acid codes, with these exceptions: | ||
+ | * lower-case letters are accepted and are mapped into upper-case | ||
+ | * a single hyphen or dash can be used to represent a gap character | ||
+ | * in amino acid sequences: U and * are acceptable letters | ||
+ | * Numerical digits are not allowed but are used in some databases to indicate the position in the sequence | ||
+ | |||
+ | \\ | ||
+ | The nucleic acid codes supported are: | ||
+ | |||
+ | ^ Nucleic Acid Code ^ Meaning | ||
+ | | | ||
+ | | | ||
+ | | | ||
+ | | | ||
+ | | | ||
+ | | | ||
+ | | | ||
+ | | | ||
+ | | | ||
+ | | | ||
+ | | | ||
+ | | | ||
+ | | | ||
+ | | | ||
+ | | | ||
+ | | | ||
+ | | | ||
+ | | | ||
+ | |||
+ | \\ | ||
+ | The amino acid codes supported are: | ||
+ | |||
+ | ^ Amino Acid Code ^ Meaning ^ | ||
+ | | | ||
+ | | | ||
+ | | | ||
+ | | | ||
+ | | | ||
+ | | | ||
+ | | | ||
+ | | | ||
+ | | | ||
+ | | | ||
+ | | | ||
+ | | | ||
+ | | | ||
+ | | | ||
+ | | | ||
+ | | | ||
+ | | | ||
+ | | | ||
+ | | | ||
+ | | | ||
+ | | | ||
+ | | | ||
+ | | | ||
+ | | | ||
+ | | | ||
+ | | | ||
+ | |||
+ | |||
+ | |||
+ | |||
+ | |||
+ | |||
+ | ===== converter ===== | ||
+ | [[http:// | ||
+ | [[http:// | ||
+ | [[http:// |
fasta.1197889247.txt.gz · Last modified: 2008/07/22 13:30 (external edit)